PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g001610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 566aa    MW: 61734.2 Da    PI: 7.2067
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g001610.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.95.9e-10418476563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+ e+  l++++
  Csa10g001610.1 418 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQREMIGLTNQN 476
                     899********************************************999887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-19414478IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.955416479IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.1E-12418475No hitNo description
PfamPF001701.3E-8418474IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.04E-12418474No hitNo description
CDDcd147031.41E-24419468No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MGDTEKCSNT TDHMIQRLHS SFGTSSSSTP KHATAPIHHH QQQQQQLDLN PNFLRSSTTP  60
TSPQFPQFSK PFSDCAKRIG VPPSHPNLIP PPTSPFSQIP TSRQPASLHS HSRSLSQPNS  120
FFSFDSLPPL SPSPFRDSLS AAQLPDHDVS MEDPDSAGFS LPPSSPFTRC NSSTSSTSSV  180
RAGESLPPRK SHRRSSSDIP SGFNNSMNSL PLIPPRPLER SFSGGECADW SKSAPFVKKE  240
SSCDREGVGD REAMDDLFSA YMNLENIDVL NSSEAEDSKN GGGTNENRDD MDSSRASGTK  300
TNNGSDTEGE SSSVNESANT GVKRRAAGGD IAPTTRHYRS VSVDSCFMEK LSFGDESLKP  360
PLSPGTISRK VSPTNSVDGN SGAAAFSIEF KNGEFTAAEL KKIMANDKLA EMAMSDPKRV  420
KRILANRQSA ARSKERKMRY IVELEHKVQT LQTEATTLSA QLTLLQREMI GLTNQNNELK  480
FRLQAMEQQA RLRDALNEAL NGEVQRLKLA IGETSHNGSE RSKMQSLNAE MFQQLNISQL  540
RQQPQQSSQN QNGTMALATK PESNE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808390.0AY080839.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
GenBankAY1504350.0AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431838.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_010431839.10.0PREDICTED: probable transcription factor PosF21
TrEMBLQ8H1F00.0Q8H1F0_ARATH; Basic-leucine zipper (BZIP) transcription factor family protein
STRINGAT4G38900.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.30.0bZIP family protein